PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G22970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 309aa    MW: 32794.1 Da    PI: 8.2585
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G22970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEdell  +v+ +G+g +W + +++ g++R++k+c++rw++yl
  LPERR01G22970.1 14 RGPWSPEEDELLRSYVRSHGTGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding35.22.8e-1171111446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       T++Ed ++  + +  G++ W+ Ia++++ gRt++++k++w++
  LPERR01G22970.1  71 YTEQEDRIIWSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                      69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.218966IPR017930Myb domain
SuperFamilySSF466895.43E-2811109IPR009057Homeodomain-like
SMARTSM007178.4E-131364IPR001005SANT/Myb domain
PfamPF002491.3E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-241569IPR009057Homeodomain-like
CDDcd001678.53E-101662No hitNo description
PROSITE profilePS5129413.97267117IPR017930Myb domain
SMARTSM007171.7E-1067115IPR001005SANT/Myb domain
PfamPF002494.2E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2170116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDELLRSYVR SHGTGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTEQEDRIIW SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMAM  120
HHRQPQQQQQ QYHQHRVTLV SPPPAPQTQC ASSMQPSPAS ASSSAATTPS GGGGGACSFG  180
AAMYSPSPST AATLAAYTSM AAAAAQQSQL AELICQVPSV PPPPPPTSAA ADCWPGGVTL  240
DDVFLPELVG AAGEFPNGGD LFGGFGPLLT DRPSMAELAA CYFPIAAAPA AEMWAAAEVK  300
QAGLCHSLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794311e-153HF679431.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB25 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646212.11e-147PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0D9V4830.0A0A0D9V483_9ORYZ; Uncharacterized protein
STRINGOB01G36020.11e-146(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-69myb domain protein 36